Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Paralemmin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17962420UL
Description
Paralemmin Polyclonal specifically detects Paralemmin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Paralemmin | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001035224 | |
PALM | |
Synthetic peptide directed towards the N terminal of human PALM. Peptide sequence LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL. | |
Affinity Purified | |
RUO | |
5064 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA0270, paralemmin | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction