Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Paralemmin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Paralemmin
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17962420 View Documents View Product Certificates	Novus Biologicals NBP17962420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179624 View Documents View Product Certificates	Novus Biologicals NBP179624	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Paralemmin Polyclonal specifically detects Paralemmin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Paralemmin
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	KIAA0270, paralemmin
Gene Symbols	PALM
Isotype	IgG
Molecular Weight of Antigen	37 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_001035224
Gene ID (Entrez)	5064
Immunogen	Synthetic peptide directed towards the N terminal of human PALM. Peptide sequence LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Paralemmin Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents