PARD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238487

Catalog No. NBP238487

Description

PARD6A Polyclonal specifically detects PARD6A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PARD6A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9NPB6
• Gene Symbols: PARD6A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 50855
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: PAR-6, PAR-6 alpha, par-6 partitioning defective 6 homolog alpha (C. elegans), PAR6A, PAR6alpha, PAR-6Apar-6 (partitioning defective 6, C.elegans) homolog alpha, PAR6C, partitioning defective 6 homolog alpha, partitioning defective-6 homolog alpha, partitioning-defective protein 6, Tax interaction protein 40, TAX40, Tax-interacting protein 40, TIP-40PAR6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.