Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159496

PARL Antibody, Novus Biologicals™
SDP

Catalog No. NBP159496 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159496 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159496 Supplier Novus Biologicals Supplier No. NBP159496
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PARL Polyclonal specifically detects PARL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PARL
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H300
Gene Alias EC 3.4.21.105, mitochondrial, presenilin associated, rhomboid-like, PRO2207, rhomboid 7 homolog 1
Gene Symbols PARL
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PARL(presenilin associated, rhomboid-like) The peptide sequence was selected from the N terminal of PARL (NP_001032728). Peptide sequence SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Alzheimers Research, Apoptosis, Mitochondrial Fusion Proteins, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 55486
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Chicken: 90%.
Reconstitution Reconstitute with 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.