PARP12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156436

Catalog No. NBP156436

Description

PARP12 Polyclonal specifically detects PARP12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PARP12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.2.30, FLJ22693MST109, PARP-12, poly (ADP-ribose) polymerase family, member 12, poly [ADP-ribose] polymerase 12, ZC3H1, ZC3HDC1MSTP109, Zinc finger CCCH domain-containing protein 1, zinc finger CCCH type domain containing 1, zinc finger CCCH-type domain containing 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Equine: 92%; Mouse: 85%; Bovine: 84%; Rabbit: 83%; Canine: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9H0J9
• Gene Symbols: PARP12
• Immunogen: Synthetic peptides corresponding to PARP12(poly (ADP-ribose) polymerase family, member 12) The peptide sequence was selected from the middle region of PARP12. Peptide sequence FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL.
• Quantity: 100 μL
• Research Discipline: Apoptosis, DNA Repair, Hypoxia
• Gene ID (Entrez): 64761
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only