PARP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154680

Catalog No. NBP154680

Description

PARP2 Polyclonal specifically detects PARP2 in Human, Rat samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: PARP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, DNA Repair, Hypoxia
• Gene ID (Entrez): 10038
• Target Species: Human, Rat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: Q9UGN5
• Gene Symbols: PARP2
• Immunogen: Synthetic peptides corresponding to PARP2 (poly (ADP-ribose) polymerase family, member 2) The peptide sequence was selected from the middle region of PARP2. Peptide sequence LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.