Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PARP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PARP2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PARP2 Polyclonal specifically detects PARP2 in Human, Rat samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.Specifications
PARP2 | |
Polyclonal | |
Rabbit | |
Apoptosis, DNA Repair, Hypoxia | |
ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2 | |
PARP2 | |
IgG | |
61 kDa |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Q9UGN5 | |
10038 | |
Synthetic peptides corresponding to PARP2 (poly (ADP-ribose) polymerase family, member 2) The peptide sequence was selected from the middle region of PARP2. Peptide sequence LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title