PARS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23391225UL

Catalog No. NB397313

Description

PARS2 Polyclonal specifically detects PARS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PARS2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q7L3T8
• Gene Symbols: PARS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YGLGVTRILAAAIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGNRLKDANKFGYP
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 25973
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp727A071, EC 6.1.1.15, MGC14416, MGC19467, MT-PRORS, probable prolyl-tRNA synthetase, mitochondrial, proline tRNA ligase 2, mitochondrial (putative), Proline--tRNA ligase, prolyl-tRNA synthetase (mitochondrial)(putative), prolyl-tRNA synthetase 2, mitochondrial (putative), prolyl-tRNA synthetase, mitochondrial (putative), proRS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only