Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pax5/BSAP Antibody, Novus Biologicals™

Pax5/BSAP Antibody, Novus Biologicals™
SDP

Catalog No. NBP238790 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238790 0.1 mL
NB396669 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238790 Supplier Novus Biologicals Supplier No. NBP238790
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Pax5/BSAP Polyclonal specifically detects Pax5/BSAP in Human, Rat, Hamster samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Pax5/BSAP
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q02548
Gene Alias B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5
Gene Symbols PAX5
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 5079
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat, Hamster
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.