Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pax5/BSAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
$416.50 - $682.00
Specifications
| Antigen | Pax5/BSAP |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Pax5/BSAP Polyclonal specifically detects Pax5/BSAP in Human, Rat, Hamster samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Pax5/BSAP | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat, Hamster | |
| Q02548 | |
| 5079 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5 | |
| PAX5 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title