Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PBLD Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

PBLD Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125353 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125353 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125353 Supplier Novus Biologicals Supplier No. NBP310226100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PBLD Polyclonal specifically detects PBLD in Mouse samples. It is validated for Western Blot.

Specifications

Antigen PBLD
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 5.1, FLJ14767, FLJ35507, MAWBPMAWDBPMAWD binding protein, MAWD-binding protein, phenazine biosynthesis-like domain-containing protein, phenazine biosynthesis-like protein domain containing, Unknown protein 32 from 2D-page of liver tissue
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PBLD (NP_080977.2). Peptide sequence GLILTVKGEPGGQTAPYDFYSRYFAPWVGIAEDPVTGSAHTVLSSYWSQQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64081
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.