PBX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231853

Catalog No. NBP231853

Description

PBX2 Polyclonal specifically detects PBX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PBX2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P40425
• Gene Symbols: PBX2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5089
• Target Species: Human
• Isotype: IgG

For Research Use Only