Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ PCAF Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258285PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCAF. Source: E.coli Amino Acid Sequence: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY The PCAF Recombinant Protein Antigen is derived from E. coli. The PCAF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
8850 | |
PCAF Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
CREBBP-associated factor, EC 2.3.1.48, GCN5L, Histone acetylase PCAF, histone acetyltransferase KAT2B, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, Lysine acetyltransferase 2B, P, P/CAFGCN5, P300/CBP-associated factorCAF, PCAF | |
Unlabeled | |
100μL | |
E.Coli |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
KAT2B | |
Recombinant Protein Antigen | |
RUO | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only