Novus Biologicals™ PCAF Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP258285PEP

Catalog No. NBP258285PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PCAF. Source: E.coli Amino Acid Sequence: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY The PCAF Recombinant Protein Antigen is derived from E. coli. The PCAF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 8850
• Common Name: PCAF Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: CREBBP-associated factor, EC 2.3.1.48, GCN5L, Histone acetylase PCAF, histone acetyltransferase KAT2B, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, Lysine acetyltransferase 2B, P, P/CAFGCN5, P300/CBP-associated factorCAF, PCAF
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.Coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: KAT2B
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52061. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only