Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PCBP1 Antibody, Novus Biologicals™

PCBP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP18045420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP18045420 20 μL
NBP180454 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP18045420 Supplier Novus Biologicals Supplier No. NBP18045420UL

Description

Rabbit Polyclonal Antibody

PCBP1 Polyclonal specifically detects PCBP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen PCBP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_006187
Gene Alias alpha-CP1, Heterogeneous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein X, hnRNP E1, hnRNP-E1, hnRNP-X, HNRPE1, HNRPX, nucleic acid binding protein sub 2.3, Nucleic acid-binding protein SUB2.3, poly(rC) binding protein 1, poly(rC)-binding protein 1
Gene Symbols PCBP1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human PCBP1. Peptide sequence CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5093
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.