PCDH11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179198

Catalog No. NBP179198

Description

PCDH11 Polyclonal specifically detects PCDH11 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PCDH11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: PCDH11, PCDH11Y, PCDH22, PCDH-PC, PCDHX, PCDH-X, PCDHY, PCDH-Y, protein phosphatase 1, regulatory subunit 119, protocadherin 11X, protocadherin 22, Protocadherin on the X chromosome, Protocadherin on the Y chromosome, Protocadherin prostate cancer, protocadherin-11 X-linked, Protocadherin-11 Y-linked, Protocadherin-22, protocadherin-PC, Protocadherin-S
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27328
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001074854
• Gene Symbols: PCDH11
• Immunogen: The immunogen for this antibody is Pcdh11x. Peptide sequence LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: The immunogen sequence has 100% identity to both PCDH11X and PCDH11Y.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG