PCDHA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159252

Catalog No. NBP159252

Description

PCDHA12 Polyclonal specifically detects PCDHA12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PCDHA12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0345-like 2, MGC138485, MGC141932, PCDH-alpha-12, PCDH-ALPHA12, protocadherin alpha 12, protocadherin alpha-12
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56137
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UN75
• Gene Symbols: PCDHA12
• Immunogen: Synthetic peptides corresponding to PCDHA12(protocadherin alpha 12) The peptide sequence was selected from the N terminal of PCDHA12. Peptide sequence EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 87%; Mouse: 85%; Rat: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG