Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PCDHA12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCDHA12 Polyclonal specifically detects PCDHA12 in Human samples. It is validated for Western Blot.Specifications
PCDHA12 | |
Polyclonal | |
Rabbit | |
Q9UN75 | |
56137 | |
Synthetic peptides corresponding to PCDHA12(protocadherin alpha 12) The peptide sequence was selected from the N terminal of PCDHA12. Peptide sequence EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0345-like 2, MGC138485, MGC141932, PCDH-alpha-12, PCDH-ALPHA12, protocadherin alpha 12, protocadherin alpha-12 | |
PCDHA12 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title