Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15926220UL
Description
PCDHA6 Polyclonal specifically detects PCDHA6 in Human samples. It is validated for Western Blot.Specifications
PCDHA6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UN73-3 | |
PCDHA6 | |
Synthetic peptides corresponding to PCDHA6(protocadherin alpha 6) The peptide sequence was selected from the C terminal of PCDHA6. Peptide sequence LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CNR2, CNRN2, CNRS2, CRNR2, KIAA0345-like 8, PCDH-alpha-6, PCDH-ALPHA6, protocadherin alpha 6, protocadherin alpha-6 | |
Rabbit | |
Affinity Purified | |
RUO | |
56142 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction