Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHGC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15923620UL
Description
PCDHGC4 Polyclonal specifically detects PCDHGC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PCDHGC4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml, Immunohistochemistry | |
Q9Y5F7 | |
PCDHGC4 | |
Synthetic peptides corresponding to PCDHGC4(protocadherin gamma subfamily C, 4) The peptide sequence was selected from the N terminal of PCDHGC4. Peptide sequence VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC119489, MGC24978, PCDH-GAMMA-C4, protocadherin gamma subfamily C, 4, protocadherin gamma-C4 | |
Rabbit | |
Affinity Purified | |
RUO | |
56098 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction