Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHGC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | PCDHGC4 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15923620
|
Novus Biologicals
NBP15923620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159236
|
Novus Biologicals
NBP159236 |
100 μL |
Each for $487.50
|
|
|||||
Description
PCDHGC4 Polyclonal specifically detects PCDHGC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PCDHGC4 | |
| Unconjugated | |
| RUO | |
| MGC119489, MGC24978, PCDH-GAMMA-C4, protocadherin gamma subfamily C, 4, protocadherin gamma-C4 | |
| PCDHGC4 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q9Y5F7 | |
| 56098 | |
| Synthetic peptides corresponding to PCDHGC4(protocadherin gamma subfamily C, 4) The peptide sequence was selected from the N terminal of PCDHGC4. Peptide sequence VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title