Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCDHGC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | PCDHGC4 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15923620
|
Novus Biologicals
NBP15923620UL |
20 μL |
Each for $204.00
|
|
|||||
NBP159236
|
Novus Biologicals
NBP159236 |
100 μL |
Each for $482.50
|
|
|||||
Description
PCDHGC4 Polyclonal specifically detects PCDHGC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PCDHGC4 | |
Unconjugated | |
RUO | |
MGC119489, MGC24978, PCDH-GAMMA-C4, protocadherin gamma subfamily C, 4, protocadherin gamma-C4 | |
PCDHGC4 | |
IgG |
Polyclonal | |
Rabbit | |
Q9Y5F7 | |
56098 | |
Synthetic peptides corresponding to PCDHGC4(protocadherin gamma subfamily C, 4) The peptide sequence was selected from the N terminal of PCDHGC4. Peptide sequence VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title