PCGF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25769625UL

Catalog No. NB393826

Description

PCGF3 Polyclonal specifically detects PCGF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PCGF3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PCGF3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 10336
• Target Species: Human
• Isotype: IgG

For Research Use Only