PCGF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155372

Catalog No. NBP155372

Description

PCGF6 Polyclonal specifically detects PCGF6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PCGF6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MBLRMel18 and Bmi1-like RING finger protein, MGC15678, MGC17541, polycomb group ring finger 6, RING finger protein 134polycomb group RING finger protein 6, RNF134Mel18 and Bmi1-like RING finger
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 84108
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BYE7
• Gene Symbols: PCGF6
• Immunogen: Synthetic peptides corresponding to the middle region of human PCGF6 (polycomb group ring finger 6)(NP_115530). Peptide sequence: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.