Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PCGF6 Antibody, Novus Biologicals™

PCGF6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15537220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15537220 20 μL
NBP155372 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15537220 Supplier Novus Biologicals Supplier No. NBP15537220UL

Description

Rabbit Polyclonal Antibody

PCGF6 Polyclonal specifically detects PCGF6 in Human samples. It is validated for Western Blot.

Specifications

Antigen PCGF6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9BYE7
Gene Alias MBLRMel18 and Bmi1-like RING finger protein, MGC15678, MGC17541, polycomb group ring finger 6, RING finger protein 134polycomb group RING finger protein 6, RNF134Mel18 and Bmi1-like RING finger
Gene Symbols PCGF6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of human PCGF6 (polycomb group ring finger 6)(NP_115530). Peptide sequence: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 84108
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.