PCP4 Antibody (CL5306), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP261410

Catalog No. NBP261410

Description

PCP4 Monoclonal specifically detects PCP4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PCP4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PCP4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
• Quantity: 100 μL
• Gene ID (Entrez): 5121
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Immunohistochemistry (Paraffin)
• Clone: CL5306
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4, Brain-specific polypeptide PEP-19, PEP19, PEP-19, Purkinje cell protein 4
• Host Species: Mouse
• Purification Method: Protein A purified
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1