Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 5 publications
$670.00
Specifications
| Antigen | PCP4 |
|---|---|
| Concentration | 0.05mg/mL |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
Description
PCP4 Polyclonal specifically detects PCP4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PCP4 | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4, Brain-specific polypeptide PEP-19, PEP19, PEP-19, Purkinje cell protein 4 | |
| PCP4 | |
| IgG | |
| Affinity Purified | |
| Specificity of human PCP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.05mg/mL | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| P48539 | |
| 5121 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title