PCPE-1/PCOLCE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255270

Catalog No. NBP255270

Description

PCPE-1/PCOLCE Polyclonal specifically detects PCPE-1/PCOLCE in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

• Antigen: PCPE-1/PCOLCE
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockdown Validated
• Gene Alias: PCPE, PCPE-1, PCPE1Type I procollagen COOH-terminal proteinase enhancer, procollagen C-endopeptidase enhancer, procollagen C-endopeptidase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Procollagen C-proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, Type 1 procollagen C-proteinase enhancer protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PCOLCE
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5118
• Target Species: Human
• Isotype: IgG

For Research Use Only