Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PCPE-1/PCOLCE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
Antigen | PCPE-1/PCOLCE |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PCPE-1/PCOLCE Polyclonal specifically detects PCPE-1/PCOLCE in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
PCPE-1/PCOLCE | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5118 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
Unconjugated | |
RUO | |
Human | |
PCPE, PCPE-1, PCPE1Type I procollagen COOH-terminal proteinase enhancer, procollagen C-endopeptidase enhancer, procollagen C-endopeptidase enhancer 1, Procollagen COOH-terminal proteinase enhancer 1, Procollagen C-proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, Type 1 procollagen C-proteinase enhancer protein | |
PCOLCE | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title