Learn More
Description
Specifications
Specifications
| Antigen | PCYT1A |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 1D9L4 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CCT A, CCT-alpha, choline-phosphate cytidylyltransferase A, CT, CT A, CTA, CTP:phosphocholine cytidylyltransferase A, CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform, EC 2.7.7, EC 2.7.7.15, PCYT1CCTA, phosphate cytidylyltransferase 1, choline, alpha, Phosphorylcholine transferase A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 268-367 of human PCYT1A (P49585). EEKSIDLIQKWEEKSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYDISEDEED |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
