Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PD-ECGF/Thymidine Phosphorylase Antibody, Novus Biologicals™

PD-ECGF/Thymidine Phosphorylase Antibody, Novus Biologicals™
SDP

Catalog No. NB432437 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432437 25ul
NBP184916 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432437 Supplier Novus Biologicals Supplier No. NBP18491625UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

PD-ECGF/Thymidine Phosphorylase Polyclonal specifically detects PD-ECGF/Thymidine Phosphorylase in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PD-ECGF/Thymidine Phosphorylase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P19971
Gene Alias EC 2.4.2, EC 2.4.2.4, ECGF, ECGF1TP, endothelial cell growth factor 1 (platelet-derived), Gliostatin, hPD-ECGF, MEDPS1, MNGIE, MTDPS1, PDECGF, PD-ECGF, Platelet-derived endothelial cell growth factor, TdRPase, thymidine phosphorylase
Gene Symbols TYMP
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Molecular Weight of Antigen 50 kDa
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Angiogenesis
Primary or Secondary Primary
Gene ID (Entrez) 1890
Test Specificity Specificity of human PD-ECGF/Thymidine Phosphorylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.