PDCD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18265625UL

Catalog No. NB407085

Description

PDCD5 Polyclonal specifically detects PDCD5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PDCD5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Gene Alias: FLJ42784, MGC9294, programmed cell death 5, programmed cell death protein 5, Protein TFAR19, TF-1 cell apoptosis-related protein 19, TFAR19 novel apoptosis-related, TFAR19TF1 cell apoptosis-related gene 19
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PDCD5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 9141
• Target Species: Human
• Isotype: IgG

For Research Use Only