Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDE1C Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152956

 View more versions of this product

Catalog No. NBP152956


Only null left
Add to Cart

Description

Description

PDE1C Polyclonal specifically detects PDE1C in Human samples. It is validated for Western Blot.
Specifications

Specifications

PDE1C
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
calmodulin-dependent (70kD), EC 3.1.4, phosphodiesterase 1C, calmodulin-dependent 70kDa
Rabbit
72 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q8TAE4
PDE1C
Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C, calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR.
Affinity purified
RUO
5137
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.