Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PDE1C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PDE1C Polyclonal specifically detects PDE1C in Human samples. It is validated for Western Blot.Specifications
| PDE1C | |
| Polyclonal | |
| Rabbit | |
| Q8TAE4 | |
| 5137 | |
| Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C, calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calmodulin-dependent (70kD), EC 3.1.4, phosphodiesterase 1C, calmodulin-dependent 70kDa | |
| PDE1C | |
| IgG | |
| 72 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title