Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PDE1C |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PDE1C Polyclonal specifically detects PDE1C in Human samples. It is validated for Western Blot.Specifications
PDE1C | |
Polyclonal | |
Rabbit | |
Q8TAE4 | |
5137 | |
Synthetic peptides corresponding to PDE1C(phosphodiesterase 1C, calmodulin-dependent 70kDa) The peptide sequence was selected from the middle region of PDE1C. Peptide sequence IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
calmodulin-dependent (70kD), EC 3.1.4, phosphodiesterase 1C, calmodulin-dependent 70kDa | |
PDE1C | |
IgG | |
72 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title