Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDE6A Antibody, Novus Biologicals™

PDE6A Antibody, Novus Biologicals™
SDP

Catalog No. NB392798 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392798 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392798 Supplier Novus Biologicals Supplier No. NBP26898525UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PDE6A Polyclonal antibody specifically detects PDE6A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PDE6A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CGPR-A, EC 3.1.4, EC 3.1.4.35, GMP-PDE alpha, PDE V-B1, PDEAcGMP phosphodiesterase alpha subunit, phosphodiesterase 6A, cGMP-specific, rod, alpha, rod cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha, rod photoreceptor cGMP phosphodiesterase alpha subunit, RP43
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 5145
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.