Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDE6H Antibody, Novus Biologicals™

PDE6H Antibody, Novus Biologicals™
SDP

Catalog No. NB392971 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392971 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392971 Supplier Novus Biologicals Supplier No. NBP26865925UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PDE6H Polyclonal antibody specifically detects PDE6H in Human, Monkey samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)

Specifications

Antigen PDE6H
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:35024589)
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 3.1.4.17, EC 3.1.4.35, GMP-PDE gamma, phosphodiesterase 6H, cGMP-specific, cone, gamma, RCD3, retinal cone rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitgamma
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 5149
Target Species Human, Monkey
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.