PDE6H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26865925UL

Catalog No. NB392971

Description

PDE6H Polyclonal antibody specifically detects PDE6H in Human, Monkey samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)

Specifications

• Antigen: PDE6H
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:35024589)
• Gene Alias: EC 3.1.4.17, EC 3.1.4.35, GMP-PDE gamma, phosphodiesterase 6H, cGMP-specific, cone, gamma, RCD3, retinal cone rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitgamma
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA
• Quantity: 25 μL
• Research Discipline: Signal Transduction, Vision
• Gene ID (Entrez): 5149
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Monkey
• Form: Purified