Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE6H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | PDE6H |
|---|---|
| Dilution | Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:35024589) |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PDE6H Polyclonal antibody specifically detects PDE6H in Human, Monkey samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)Specifications
| PDE6H | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction, Vision | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5149 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunohistochemistry-Frozen -Reported in scientific literature (PMID:35024589) | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Monkey | |
| EC 3.1.4.17, EC 3.1.4.35, GMP-PDE gamma, phosphodiesterase 6H, cGMP-specific, cone, gamma, RCD3, retinal cone rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitgamma | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title