PDE8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18628025UL

Catalog No. NB432059

Description

PDE8B Polyclonal specifically detects PDE8B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PDE8B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: 3'-5' cyclic nucleotide phosphodiesterase 8B, ADSD, Cell proliferation-inducing gene 22 protein, EC 3.1.4.17, FLJ11212, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B, hsPDE8B, phosphodiesterase 8B, PPNAD3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PDE8B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPS
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 8622
• Target Species: Human
• Isotype: IgG

For Research Use Only