Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDE8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258096
Description
PDE8B Polyclonal specifically detects PDE8B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PDE8B | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
3'-5' cyclic nucleotide phosphodiesterase 8B, ADSD, Cell proliferation-inducing gene 22 protein, EC 3.1.4.17, FLJ11212, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8B, hsPDE8B, phosphodiesterase 8B, PPNAD3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PDE8B | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRHCCSSAEAETQTCYTSVKQVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLD | |
100 μL | |
Lipid and Metabolism, Signal Transduction | |
8622 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction