PDF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238993

Catalog No. NBP238993

Description

PDF Polyclonal specifically detects PDF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PDF
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9HBH1
• Gene Symbols: PDF
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.5.1.88, GDF15, MIC1, PDF1A, peptide deformylase (mitochondrial), peptide deformylase, mitochondrial, peptide deformylase-like protein, PLAB, Polypeptide deformylase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64146
• Target Species: Human
• Isotype: IgG