Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157999

PDIA6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157999 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157999 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157999 Supplier Novus Biologicals Supplier No. NBP157999
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PDIA6 Polyclonal specifically detects PDIA6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

Antigen PDIA6
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15084
Gene Alias EC 5.3.4.1, Endoplasmic reticulum protein 5, ERp5, ERP5ER protein 5, P5TXNDC7, protein disulfide isomerase family A, member 6, Protein disulfide isomerase P5, protein disulfide isomerase-associated 6, protein disulfide isomerase-related protein, protein disulfide-isomerase A6, thioredoxin domain containing 7 (protein disulfide isomerase), Thioredoxin domain-containing protein 7
Gene Symbols PDIA6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PDIA6(protein disulfide isomerase family A, member 6) The peptide sequence was selected from the N terminal of PDIA6. Peptide sequence KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10130
Test Specificity Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Bovine: 85%; Chicken: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.