Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDP1/PPAPDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP160021
Description
PDP1/PPAPDC2 Polyclonal specifically detects PDP1/PPAPDC2 in Human samples. It is validated for Western Blot.Specifications
PDP1/PPAPDC2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
bA6J24.6, EC 3.1.3, EC 3.1.3.-, FLJ46512, FLJ90191, MGC15483, PDP1, phosphatidic acid phosphatase type 2 domain containing 2, Phosphatidic acid phosphatase type 2 domain-containing protein 2, polyisoprenoid diphosphate phosphatase type 1, PPAP2 domain-containing protein 2, presqualene diphosphate phosphatase, PSDP | |
Rabbit | |
32 kDa | |
100 μL | |
Primary | |
Rat 87%, Canine 86%, Porcine 81%, Mouse 79%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8IY26 | |
PLPP6 | |
Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA. | |
Affinity purified | |
RUO | |
403313 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction