Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDP1/PPAPDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PDP1/PPAPDC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PDP1/PPAPDC2 Polyclonal specifically detects PDP1/PPAPDC2 in Human samples. It is validated for Western Blot.Specifications
PDP1/PPAPDC2 | |
Polyclonal | |
Rabbit | |
Q8IY26 | |
403313 | |
IgG | |
32 kDa |
Western Blot | |
Unconjugated | |
RUO | |
bA6J24.6, EC 3.1.3, EC 3.1.3.-, FLJ46512, FLJ90191, MGC15483, PDP1, phosphatidic acid phosphatase type 2 domain containing 2, Phosphatidic acid phosphatase type 2 domain-containing protein 2, polyisoprenoid diphosphate phosphatase type 1, PPAP2 domain-containing protein 2, presqualene diphosphate phosphatase, PSDP | |
Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title