Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDP1/PPAPDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP160022
Description
PDP1/PPAPDC2 Polyclonal specifically detects PDP1/PPAPDC2 in Human samples. It is validated for Western Blot.Specifications
| PDP1/PPAPDC2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| bA6J24.6, EC 3.1.3, EC 3.1.3.-, FLJ46512, FLJ90191, MGC15483, PDP1, phosphatidic acid phosphatase type 2 domain containing 2, Phosphatidic acid phosphatase type 2 domain-containing protein 2, polyisoprenoid diphosphate phosphatase type 1, PPAP2 domain-containing protein 2, presqualene diphosphate phosphatase, PSDP | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 403313 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8IY26 | |
| PLPP6 | |
| Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%;. | |
| Human, Canine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction