PDP1/PPAPDC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160022

Catalog No. NBP160022

Description

PDP1/PPAPDC2 Polyclonal specifically detects PDP1/PPAPDC2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDP1/PPAPDC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA6J24.6, EC 3.1.3, EC 3.1.3.-, FLJ46512, FLJ90191, MGC15483, PDP1, phosphatidic acid phosphatase type 2 domain containing 2, Phosphatidic acid phosphatase type 2 domain-containing protein 2, polyisoprenoid diphosphate phosphatase type 1, PPAP2 domain-containing protein 2, presqualene diphosphate phosphatase, PSDP
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 403313
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IY26
• Gene Symbols: PLPP6
• Immunogen: Synthetic peptides corresponding to PPAPDC2(phosphatidic acid phosphatase type 2 domain containing 2) The peptide sequence was selected from the N terminal of PPAPDC2. Peptide sequence FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human, Canine
• Isotype: IgG