PDP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157641

Catalog No. NBP157641

Description

PDP2 Polyclonal specifically detects PDP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3, EC 3.1.3.43, KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial, PDP 2, PDPC 2, PPM2C2, protein phosphatase 2C, magnesium-dependent, catalytic subunit 2, Pyruvate dehydrogenase phosphatase catalytic subunit 2, pyruvate dehydrogenase phosphatase isoenzyme 2, pyruvate dehydrogenase phosphatase, catalytic subunit 2, pyruvate dehyrogenase phosphatase catalytic subunit 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Equine: 92%; Rabbit: 92%; Rat: 92%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P2J9
• Gene Symbols: PDP2
• Immunogen: Synthetic peptides corresponding to PDP2 (pyruvate dehyrogenase phosphatase catalytic subunit 2) The peptide sequence was selected from the middle region of PDP2. Peptide sequence LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV.
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 57546
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.