PDZRN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP25580225UL

Catalog No. NB403869

Description

PDZRN3 Polyclonal specifically detects PDZRN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PDZRN3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: E3 ubiquitin-protein ligase PDZRN3, EC 6.3.2.-, Ligand of Numb protein X 3, likely ortholog of mouse semaF cytoplasmic domain associated protein 3, LNX3KIAA1095SEMACAP3, PDZ domain containing ring finger 3, PDZ domain-containing RING finger protein 3, Protein SEMACAP3, Semaphorin cytoplasmic domain-associated protein 3, SEMCAP3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PDZRN3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 23024
• Target Species: Human
• Isotype: IgG

For Research Use Only