Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDZRN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$382.00 - $610.00

Specifications

Antigen	PDZRN3
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP255802 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP255802	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403869 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25580225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PDZRN3 Polyclonal specifically detects PDZRN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	PDZRN3
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	23024
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	E3 ubiquitin-protein ligase PDZRN3, EC 6.3.2.-, Ligand of Numb protein X 3, likely ortholog of mouse semaF cytoplasmic domain associated protein 3, LNX3KIAA1095SEMACAP3, PDZ domain containing ring finger 3, PDZ domain-containing RING finger protein 3, Protein SEMACAP3, Semaphorin cytoplasmic domain-associated protein 3, SEMCAP3
Gene Symbols	PDZRN3
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PDZRN3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents