PDZRN4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154925

Catalog No. NBP154925

Description

PDZRN4 Polyclonal specifically detects PDZRN4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDZRN4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp434B0417, IMAGE5767589, Ligand of Numb protein X 4, LNX4FLJ33777, PDZ domain containing ring finger 4, PDZ domain-containing RING finger protein 4, SAMCAP3L, SEMACAP3-like protein, SEMCAP3L
• Host Species: Rabbit
• Molecular Weight of Antigen: 89 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 29951
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B4DG65
• Gene Symbols: PDZRN4
• Immunogen: Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.