Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDZRN4 Antibody, Novus Biologicals™

PDZRN4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15492520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15492520 20 μL
NBP154925 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15492520 Supplier Novus Biologicals Supplier No. NBP15492520UL

Description

Rabbit Polyclonal Antibody

PDZRN4 Polyclonal specifically detects PDZRN4 in Human samples. It is validated for Western Blot.

Specifications

Antigen PDZRN4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. B4DG65
Gene Alias DKFZp434B0417, IMAGE5767589, Ligand of Numb protein X 4, LNX4FLJ33777, PDZ domain containing ring finger 4, PDZ domain-containing RING finger protein 4, SAMCAP3L, SEMACAP3-like protein, SEMCAP3L
Gene Symbols PDZRN4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
Molecular Weight of Antigen 89 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 29951
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.