Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEA-15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26267025UL
Description
PEA-15 Polyclonal antibody specifically detects PEA-15 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PEA-15 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
HMAT115kD, PEA-15, PED15 kDa phosphoprotein enriched in astrocytes, phosphoprotein enriched in astrocytes 15, Phosphoprotein enriched in diabetes | |
This antibody was developed against a recombinant protein corresponding to amino acids: PPWPGQTSPVMAEYGTLLQDLTNNITLEDLGQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLD | |
25 μL | |
Apoptosis, Cell Biology, Cellular Markers | |
8682 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction